PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g098815.1
Common NameMTR_8g098815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TALE
Protein Properties Length: 621aa    MW: 70151.8 Da    PI: 6.7357
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g098815.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.7e-093894261954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Medtr8g098815.1 389 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 426
                      664459******************************88 PP

2BELL120.95.5e-39251321272
             BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      + elqk+k+kLls+leeVd+rYk+y++q++ v+ssFeavag g+ak+Y +lAlka+SrhFrcLkd i eqi
  Medtr8g098815.1 251 FVELQKRKTKLLSMLEEVDRRYKHYCNQMRSVVSSFEAVAGNGAAKVYSALALKAMSRHFRCLKDGILEQI 321
                      679*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-58180319IPR006563POX domain
PfamPF075262.2E-48186317IPR006563POX domain
PROSITE profilePS5007112.05367430IPR001356Homeobox domain
SMARTSM003897.0E-9370434IPR001356Homeobox domain
CDDcd000865.15E-11370431No hitNo description
SuperFamilySSF466893.76E-17371436IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.4E-28373436IPR009057Homeodomain-like
PfamPF059208.2E-18387426IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MARQLCHEDD KTSSGGFCYN PTIQTQIQGF VSDPEMFNLT TGMEMIGFSK QHLQQHSTDT  60
TNSVMWKTNF SGKLSQQHVG PSSSSKTMND NFYHHQDFTV SDTTSSDQNL NNMVHHDSSS  120
HHQWQQVDDS SLRCVFPCEG NERPSQGLSL SLSSTNPSSI GLQSFELRHT TNHHLQDQGY  180
QGHFLLKNSK FLLPAQELLN EFCSLESTKQ NDLVLQKQKS QKFNNKQSWE DDNNNGGSSS  240
SIKQSLTSVE FVELQKRKTK LLSMLEEVDR RYKHYCNQMR SVVSSFEAVA GNGAAKVYSA  300
LALKAMSRHF RCLKDGILEQ IQTTRKAMGE KDPVAPGTTK GETPRLKILD RVLRQQRAFQ  360
QINMMETHPW RPQRGLPERS VSILRAWLFE HFLHPYPSDV DKHILARQTG LSRSQVSNWF  420
INARVRLWKP MVEEMYLEEE KEQQRNTTTS DGGNNINHEE DNLNVLQNQS QTQPHEDQKP  480
RLLRIDSECV SSIINNDHKN DANNKNLNHH QLAADAFGSV DIDFSSYNTH HSSSDMVAAY  540
TSGESFHQGG SSGGVSLTLG LQQHGGNGVS LAFPPTSQSP MFYTRDQIEE PVQYSLLDGE  600
GTNIMPYRNL MGTQLLHDLA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15376434563Homeobox protein Meis2
3k2a_B1e-15376434563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.70130.0glandular trichome| leaf| pod| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013447087.10.0BEL1-related homeotic protein
SwissprotQ388971e-135BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A072TUA60.0A0A072TUA6_MEDTR; BEL1-related homeotic protein
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-111TALE family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]